Description

  • Product name

    Recombinant Mouse PDXP protein (Tagged)
    See all PDXP proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MARCERLRGAALRDVLGQAQGVLFDCDGVLWNGERIVPGAPELLQRLARA GKNTLFVSNNSRRARPELALRFARLGFAGLRAEQLFSSALCAARLLRQRL SGPPDASGAVFVLGGEGLRAELRAAGLRLAGDPGEDPRVRAVLVGYDEQF SFSRLTEACAHLRDPDCLLVATDRDPWHPLSDGSRTPGTGSLAAAVETAS GRQALVVGKPSPYMFQCITEDFSVDPARTLMVGDRLETDILFGHRCGMTT VLTLTGVSSLEEAQAYLTAGQRDLVPHYYVESIADLMEGLED
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      1 to 292
    • Tags

      His tag N-Terminus
    • Additional sequence information

      6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab226443 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Chronophin
    • CIN
    • Pdxp
    • PLP
    • PLP phosphatase
    • PLPP
    • PLPP_HUMAN
    • Pyridoxal (pyridoxine, vitamin B6) phosphatase
    • Pyridoxal phosphate phosphatase
    • Rbp1
    • Reg I binding protein 1
    • RP1 37E16.5
    see all
  • Function

    Protein serine phosphatase that dephosphorylates 'Ser-3' in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis. Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho-tyrosine. Pyridoxal phosphate phosphatase. Has some activity towards pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PMP) and pyridoxine 5'-phosphate (PNP), with a highest activity with PLP followed by PNP.
  • Tissue specificity

    Ubiquitous. Highly expressed in all the regions of central nerve system except the spinal cord. Also expressed at high level in liver and testis. In fetus, it is weakly expressed in all organs except brain.
  • Sequence similarities

    Belongs to the HAD-like hydrolase superfamily.
  • Cellular localization

    Cytoplasm, cytosol. Cytoplasm, cytoskeleton. Cell projection, ruffle membrane. Cell projection, lamellipodium membrane. Cell membrane. Colocalizes with the actin cytoskeleton in membrane ruffles and lamellipodia. Diffusely distributed throughout the cytosol during pro-metaphase and metaphase. Detected at the dynamic cell poles during telophase. Detected at the cleavage furrow and contractile ring during cytokinesis. Transiently detected at the plasma membrane in late stages of cytokinesis. Detected at the midbody.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226443 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab226443 could indicate that this peptide derived from E.coli-expressed mouse PDXP.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab226443 could indicate that this peptide derived from E.coli-expressed mouse PDXP.

References

ab226443 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226443.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up