Description

  • Product name

    Recombinant Mouse PEDF protein
    See all PEDF proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MDPFFKVPVNKLAAAVSNFGYDLYRLRSSASPTGNVLLSPLSVATALSAL SLGAEHRTESVIHRA LYYDLITNPDIHSTYKELLASVTAPEKNLKSASRIVFERKLRVKSSFVAP LEKSYGTRPRILTGN PRVDLQEINNWVQAQMKGKIARSTREMPSALSILLLGVAYFKGQWVTKFD SRKTTLQDFHLDEDR TVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLTVTQNLT MIEESLTSEFIHDID RELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSLFESPDFSKITGKPVK LTQVEHRAAFEWNEE GAGSSPSPGLQPVRLTFPLDYHLNQPFLFVLRDTDTGALLFIGRILDPSS T
    • Predicted molecular weight

      46 kDa
    • Amino acids

      43 to 417

Specifications

Our Abpromise guarantee covers the use of ab185860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS.

General Info

  • Alternative names

    • Cell proliferation-inducing gene 35 protein
    • EPC 1
    • EPC-1
    • EPC1
    • OI12
    • OI6
    • PEDF
    • PEDF_HUMAN
    • PIG 35
    • PIG35
    • Pigment epithelium derived factor
    • Pigment epithelium-derived factor
    • Proliferation inducing protein 35
    • Serine (or cysteine) proteinase inhibitor
    • serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
    • Serpin F1
    • Serpin family F member 1
    • Serpin peptidase inhibitor
    • Serpin peptidase inhibitor clade F member 1
    • serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
    • SERPINF 1
    • Serpinf1
    see all
  • Function

    Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
  • Tissue specificity

    Retinal pigment epithelial cells and blood plasma.
  • Sequence similarities

    Belongs to the serpin family.
  • Developmental stage

    Expressed in quiescent cells.
  • Domain

    The N-terminal (AA 44-121) exhibits neurite outgrowth-inducing activity. The C-terminal exposed loop (AA 382-418) is essential for serpin activity.
  • Post-translational
    modifications

    The N-terminus is blocked. Extracellular phosphorylation enhances antiangiogenic activity.
    N- and O-glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.
  • Cellular localization

    Secreted. Melanosome. Enriched in stage I melanosomes.
  • Information by UniProt

References

ab185860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up