Description

  • Product name

    Recombinant Mouse Peroxiredoxin 6 protein
    See all Peroxiredoxin 6 proteins and peptides
  • Purity

    > 99 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      HHHHHHGSGGSGPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSH PRDF TPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDIN AYNGETPTEKLPF PIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVF IFGPDKKLKLSILYPATTGRNF DEILRVVDSLQLTGTKPVATPVDWKK GESVMVVPTLSEEEAKQCFPKGVFTKELPS GKKYLRYTPQP
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      2 to 224
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab195174 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Sandwich ELISA

  • Form

    Liquid
  • Additional notes

    Product was previously marketed under the MitoSciences sub-brand.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.2% Monobasic dihydrogen potassium phosphate, 2.16% Sodium phosphate dibasic heptahydrate, 0.2% Potassium chloride, 8.06% Sodium chloride, 10% Trehalose

General Info

  • Alternative names

    • 1 Cys
    • 1 Cys peroxiredoxin
    • 1 Cys PRX
    • 1 cysPrx
    • 1-Cys peroxiredoxin
    • 1-Cys PRX
    • 24 kDa protein
    • 9430088D19Rik
    • AA690119
    • Acidic calcium independent phospholipase A2
    • Acidic calcium-independent phospholipase A2
    • aiPLA2
    • Antioxidant protein 2
    • AOP2
    • Aop2 rs3
    • Brp 12
    • Ciliary body glutathione peroxidase
    • CP 3
    • EC 1.11.1.15
    • EC 1.11.1.7
    • EC 3.1.1.
    • Epididymis secretory sperm binding protein Li 128m
    • GPx
    • HEL S 128m
    • KIAA0106
    • Liver 2D page spot 40
    • Ltw4
    • Lvtw 4
    • MGC46173
    • mKIAA0106
    • Non selenium glutathione peroxidase
    • Non-selenium glutathione peroxidase
    • NSGPx
    • ORF06
    • OTTHUMP00000032693
    • p29
    • Peroxiredoxin-6
    • Peroxiredoxin6
    • PHGPx
    • Phospholipase A2 lysosomal
    • PLA2
    • PRDX 6
    • Prdx5
    • PRDX6
    • Prdx6 rs3
    • PRDX6_HUMAN
    • PRX
    • Red blood cells page spot 12
    • Thiol specific antioxidant protein
    see all
  • Function

    Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.
  • Sequence similarities

    Belongs to the ahpC/TSA family. Rehydrin subfamily.
    Contains 1 thioredoxin domain.
  • Cellular localization

    Cytoplasm. Lysosome. Cytoplasmic vesicle. Also found in lung secretory organelles.
  • Information by UniProt

Images

  • SDS PAGE gel stained with colloidal coomassie blue

    Lane 1: Ladder
    Lane 2: ab195174, 500ng

     

  • Example of data generated using ab195174 in a sandwich ELISA.

  • Example of data generated using ab195174 in a direct ELISA.

References

ab195174 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab195174.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up