Description

  • Product name

    Recombinant mouse PGAM1 protein (His tag)
    See all PGAM1 proteins and peptides
  • Biological activity

    Specific activity is >150 units/mg, in which 1 unit will convert 1.0 µmole of 3-phosphoglycerate to 2-phosphoglycerate per minute at pH 7.6 at 37°C

  • Purity

    > 95 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMAAYKLVLIRHGESAWNLENRFSGWY DADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQ MWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPM EPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIK EGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKP IKPMQFLGDEETVRKAMEAVAAQGKVKK
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      1 to 254
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab222452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.02% DTT, 20% Glycerol, 0.58% Sodium chloride, 0.32% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • BPG dependent PGAM 1
    • BPG dependent PGAM1
    • BPG-dependent PGAM 1
    • OTTHUMP00000059414
    • PGAM 1
    • PGAM A
    • PGAM B
    • PGAM-B
    • PGAM1
    • PGAM1_HUMAN
    • PGAMA
    • PGAMB
    • Phosphoglycerate mutase 1
    • Phosphoglycerate mutase 1 brain
    • Phosphoglycerate mutase A
    • Phosphoglycerate mutase A nonmuscle form
    • Phosphoglycerate mutase isozyme B
    see all
  • Function

    Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
  • Tissue specificity

    In mammalian tissues there are two types of phosphoglycerate mutase isozymes: type-M in muscles and type-B in other tissues.
  • Sequence similarities

    Belongs to the phosphoglycerate mutase family. BPG-dependent PGAM subfamily.
  • Information by UniProt

Images

  • 3 μg ab222452 analyzed by 15% SDS-PAGE.

References

ab222452 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222452.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up