Description

  • Product name

    Recombinant Mouse PLA2G5 protein (Tagged)
    See all PLA2G5 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRC YGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRR NLWTYNPLYQYYPNFLC
    • Predicted molecular weight

      16 kDa
    • Amino acids

      21 to 137
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature protein without the signal peptide (1-20aa). N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Secretory phospholipase A2 Type V

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Ca2+ dependent phospholipase A2
    • Calcium dependent phospholipase A2
    • Calcium-dependent phospholipase A2
    • DKFZp686C2294
    • FRFB
    • Group V phospholipase A2
    • GV PLA2
    • gVPLA2
    • hVPLA(2)
    • MGC46205
    • OTTHUMP00000044655
    • PA2G5_HUMAN
    • Phosphatidylcholine 2 acylhydrolase
    • Phosphatidylcholine 2-acylhydrolase 5
    • Phospholipase A2 group V
    • PLA2 10
    • PLA2 G5
    • PLA2-10
    • Pla2g5
    • sPLA2 Type V
    see all
  • Function

    PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.
  • Tissue specificity

    Heart, placenta and less abundantly, in lung.
  • Sequence similarities

    Belongs to the phospholipase A2 family.
  • Post-translational
    modifications

    This enzyme lacks one of the seven disulfide bonds found in similar PA2 proteins.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel using ab235858.

     

References

ab235858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up