Recombinant Mouse Podoplanin / gp36 protein (ab129032)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      GTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQ RERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDN AGDETQTTDKKDGLPVVTLEHHHHHH
    • Molecular weight

      13 kDa including tags
    • Amino acids

      23 to 141
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab129032 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 98 % SDS-PAGE.
    Purity is > 98% by SDS-PAGE and silver stain.
  • Form

    Lyophilised
  • Additional notes

    Endotoxin level: < 0.1ng per µg of Mouse soluble Podoplanin / gp36.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 99% PBS

  • Reconstitution
    We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml.

General Info

  • Alternative names

    • Aggrus
    • Glycoprotein 36 KD
    • Glycoprotein 36
    • gp 36
    • GP 38
    • GP 40
    • gp36
    • GP38
    • GP40
    • HT1A 1
    • HT1A1
    • hT1alpha 1
    • hT1alpha 2
    • hT1alpha1
    • hT1alpha2
    • Lung type I cell membrane associated glycoprotein
    • Lung type I cell membrane associated glycoprotein isoform a
    • Lung type I cell membrane associated glycoprotein T1A 2
    • OTS 8
    • OTS8
    • OTTHUMP00000009640
    • OTTHUMP00000044504
    • PA2.26
    • PA2.26 antigen
    • Pdpn
    • PDPN_HUMAN
    • Podoplanin
    • PSEC0003
    • PSEC0025
    • T1 alpha
    • T1 ALPHA GENE
    • T1-alpha
    • T1A
    • T1A 2
    • TI1A
    • TIA 2
    • TIA2
    see all
  • Function

    May be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. Required for normal lung cell proliferation and alveolus formation at birth. Induces platelet aggregation. Does not have any effect on folic acid or amino acid transport. Does not function as a water channel or as a regulator of aquaporin-type water channels.
  • Tissue specificity

    Highly expressed in placenta, lung, skeletal muscle and brain. Weakly expressed in brain, kidney and liver. In placenta, expressed on the apical plasma membrane of endothelium. In lung, expressed in alveolar epithelium. Up-regulated in colorectal tumors and expressed in 25% of early oral squamous cell carcinomas.
  • Sequence similarities

    Belongs to the podoplanin family.
  • Post-translational
    modifications

    Extensively O-glycosylated. Contains sialic acid residues. O-glycosylation is necessary for platelet aggregation activity.
    The N-terminus is blocked.
  • Cellular localization

    Membrane. Cell projection > filopodium membrane. Cell projection > lamellipodium membrane. Cell projection > microvillus membrane. Cell projection > ruffle membrane. Localized to actin-rich microvilli and plasma membrane projections such as filopodia, lamellipodia and ruffles.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab129032.
    Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Silver stain.

References

ab129032 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab129032.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up