Description

  • Product name

    Recombinant Mouse PODXL protein (His tag)
    See all PODXL proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purified by conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      HNGNETSTSAIKSSTVQSHQSATTSTEVTTGHPVASTLASTQPSNPTPFT TSTQSPSMPTSTPNPTSNQSGGNLTSSVSEVDKTKTSSPSSTAFTSSSGQ TASSGGKSGDSFTTAPTTTLGLINVSSQPTDLNTTSKLLSTPTTDNTTSP QQPVDSSPSTASHPVGQHTPAAVPSSSGSTPSTDNSTLTWKPTTHKPLGT SEATQPLTSQTPGITTLPVSTLQQSMASTVGTTTEEFTHLISNGTPVAPP GPSTPSPIWAFGNYQLNCEPPIRPDEELLILNLTRASLCERSPLDEKEKL VELLCHSVKASFKPAEDLCTLHVAPILDNQAVAVKRIIIETKLSPKAVYE LLKDRWDDLTEAGVSDMKLGKEGPPEVNEDRFSLEHHHHHH
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      22 to 405
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This construct lacks the N-terminal signal peptide. It corresponds to residues 22 - 405 of the mature protein.

Specifications

Our Abpromise guarantee covers the use of ab222434 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • GCTM-2 antigen
    • Gp2
    • Gp200
    • MGC138240
    • PC
    • PCLP
    • PCLP-1
    • PCLP1
    • Pcx
    • Podocalyxin
    • Podocalyxin like
    • Podocalyxin like protein
    • Podocalyxin-like protein 1
    • Podxl
    • PODXL_HUMAN
    see all
  • Function

    Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up inital epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.
  • Tissue specificity

    Glomerular epithelium cell (podocyte).
  • Sequence similarities

    Belongs to the podocalyxin family.
  • Domain

    Both the O-glycan-rich domain of the extracellular domain and the C-terminus PDZ-binding motif (DTHL) in the cytoplasmic tail harbor an apical sorting signal. The cytoplasmic domain is necessary for the apical membrane targeting and renal tubulogenesis. The cytoplasmic C-terminus PDZ-binding motif (DTHL) is essential for interaction with SLC9A3R1 and for targeting SLC9A3R1 to the apical cell membrane. The extracellular domain is necessary for microvillus formation (By similarity). The large highly anionic extracellular domain allows to maintain open filtration pathways between neighboring podocyte foot processes.
  • Post-translational
    modifications

    N- and O-linked glycosylated. Sialoglycoprotein.
  • Cellular localization

    Apical cell membrane. Cell projection, lamellipodium. Cell projection, filopodium. Cell projection, ruffle. Cell projection, microvillus. Membrane raft. Membrane. In single attached epithelial cells is restricted to a preapical pole on the free plasma membrane whereas other apical and basolateral proteins are not yet polarized. Colocalizes with SLC9A3R2 at the apical plasma membrane during epithelial polarization. Colocalizes with SLC9A3R1 at the trans-Golgi network (transiently) and at the apical plasma membrane. Its association with the membrane raft is transient. Colocalizes with actin filaments, EZR and SLC9A3R1 in a punctate pattern at the apical cell surface where microvilli form. Colocalizes with EZR and SLC9A3R2 at the apical cell membrane of glomerular epithelium cells (By similarity). Forms granular, punctuated pattern, forming patches, preferentially adopting a polar distribution, located on the migrating poles of the cell or forming clusters along the terminal ends of filipodia establishing contact with the endothelial cells. Colocalizes with the submembrane actin of lamellipodia, particularly associated with ruffles. Colocalizes with vinculin at protrusions of cells. Colocalizes with ITGB1. Colocalizes with PARD3, PRKCI, EXOC5, OCLN, RAB11A and RAB8A in apical membrane initiation sites (AMIS) during the generation of apical surface and luminogenesis (By similarity).
  • Information by UniProt

Images

  • ab222434 (3 μg) analysed on a 15% SDS-PAGE gel.

References

ab222434 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222434.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up