Bioactive grade

Recombinant mouse Prolactin/PRL protein (Active) (ab243239)

Description

  • Product name

    Recombinant mouse Prolactin/PRL protein (Active)
    See all Prolactin/PRL proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat Nb2-11 cells is less than 1.0 ng/ml, corresponding to a specific activity of >1.0x106 IU/mg.

  • Purity

    > 98 % SDS-PAGE.
    >98% as determined by SDS-PAGE and HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMV KVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGV GGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQ LPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC
    • Predicted molecular weight

      22 kDa
    • Amino acids

      30 to 226
    • Additional sequence information

      Full-length mature chain lacking the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab243239 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Decidual prolactin
    • GHA1
    • Growth hormone A1
    • Lactogenic hormone
    • Luteotropic hormone
    • Mammotropin
    • PRL
    • Prolactin
    • Prolactin precursor
    see all
  • Relevance

    Various hormones are secreted from the anterior pituitary during development and growth. Prolactin is a growth factor secreted by the anterior pituitary that is necessary for the proliferation and differentiation of the mammary glands.
  • Cellular localization

    Secreted

Images

  • SDS Page analysis of ab243239

References

ab243239 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243239.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up