Recombinant Mouse PRSS28 protein (His tag) (ab222454)

Description

  • Product name

    Recombinant Mouse PRSS28 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      KPVGIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAA HCIQSQDADPAVYRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLA LMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPY QLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCAGTSGRGPCFGD SGGPLVCWKSNKWIQVGVVSKGIDCSNNLPSIFSRVQSSLAWIHQHIQLE HHHHHH
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      27 to 274
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 27 to 274. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab222454 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • Implantation serine proteinase 1
    • ISP-1
    • PRS28_MOUSE
    • Prss28
    • Serine protease 28
    • Strypsin
    • Tryptase-like proteinase
    see all
  • Function

    Involved in embryo hatching and implantation.
  • Tissue specificity

    Expressed in embryos throughout the preimplantation period, during blastocyst hatching and embryo outgrowth. Found in uterus especially in glandular epithelium.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Developmental stage

    Highly expressed from E6.5 in embryo plus deciduum. Faintly detectable at E11.5 and E13.5 in placenta. Not detected at E8.5, E11.5 and E13.5 in embryo proper. Expressed at E4.0 in uterus.
  • Cellular localization

    Secreted. Secretion into the glandular and uterine lumen may occur as a consequence of progesterone-induced epithelial differentiation.
  • Information by UniProt

Images

  • 3 μg ab222454 analyzed by 15% SDS-PAGE.

References

ab222454 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222454.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up