Description

  • Product name

    Recombinant Mouse REG1 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYL VSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYK SWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      22 to 165
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 22 to 165 with a 6xHis-SUMO tag at the N-terminus. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • ICRF
    • Islet cells regeneration factor
    • Islet of Langerhans regenerating protein
    • Lithostathine 1 beta
    • Lithostathine-1-alpha
    • P19
    • Pancreatic stone protein
    • Pancreatic stone protein 2
    • Pancreatic thread protein
    • PSP
    • PSPS
    • PSPS1
    • PSPS2
    • PTP
    • REG
    • REG 1 beta
    • REG-1-alpha
    • REG1A
    • REG1A_HUMAN
    • REG1B
    • Regenerating islet derived protein 1 beta
    • Regenerating islet-derived protein 1-alpha
    • Regenerating protein I alpha
    • REGL
    see all
  • Function

    Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.
  • Tissue specificity

    In pancreatic acinar cells and, in lower levels, in brain. Enhanced expression of PSP-related transcripts and intraneuronal accumulation of PSP-like proteins is found in brain from Alzheimer disease and Down syndrome patients.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Developmental stage

    High expression levels in fetal and infant brains; much lower in adult brains.
  • Post-translational
    modifications

    The composition of the O-linked carbohydrate on Thr-27 is complex and varied. In the crystallographic structure, the attached sugar appears to be N-acetylglucosamine, typical of an intracellular protein, rather than N-acetylgalactosamine.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226312 with 5% enrichment gel and 15% separation gel.

References

ab226312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up