Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MEGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMT VTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
    • Molecular weight

      19 kDa
    • Amino acids

      24 to 111
    • Additional sequence information

      Dimer. This product is the mature full length protein from aa 24 to 111. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab219132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    <=1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity determined by reducing and non-reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 0.16% Sodium phosphate

    Lyophilised from a sterile (0.2 micron) filtered solution.

  • Reconstitution
    Centrifuge vial before opening. Reconstitute with sterile water at 0.1 mg/ml. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • Fizz3
    • Myeloid cysteine rich protein
    • Resistin like gamma
    • Resistin like molecule gamma
    • Retnlg
    • Xcp1
    see all
  • Relevance

    RELM gamma is a novel member of the resistin-like molecule/found in inflammatory zone (RELM/FIZZ) family in mice and rats. Micro-array and real-time RT-PCR experiments revealed a repression of RELM gamma mRNA in nasal respiratory epithelium of cigarette smoke-exposed versus untreated rats. The analysis of the physiological tissue-specific expression revealed highest expression in hematopoietic tissues, suggesting a cytokine-like role for RELM gamma. RELM-gamma-mRNA is detectable in bone marrow, spleen, and lung as well as in peripheral blood granulocytes. Promyelocytic HL60 cells transfected with a RELM gamma expression plasmid have an increased proliferation rate compared to mock-transfected cells and display an altered response to retinoic acid-induced granulocytic differentiation. Taken together, these data provide the first experimental evidence that RELM gamma is a secreted molecule with a restricted expression pattern that may play a role in promyelocytic differentiation.
  • Cellular localization

    Secreted

Images

  • 4-20% Tris Glycine gel electrophoresis of 1 µg ab219132, followed by Coomassie Blue staining.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

References

ab219132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up