Description

  • Product name

    Recombinant Mouse Renalase protein (His tag)
    See all Renalase proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      ALLRKEITAPLYLGLWDKGGDIGGRMITASSPHNPRCTADLGAQYITCSP HYVKEHQNFYEELLAHGILKPLTSPIEGMKGKEGDCNFVAPQGFSSVIKY YLKKSGAEVSLKHCVTQIHLKDNKWEVSTDTGSAEQFDLVILTMPAPQIL ELQGDIVNLISERQREQLKSVSYSSRYALGLFYEVGMKIGVPWSCRYLSS HPCICFISIDNKKRNIESSECGPSVVIQTTVPFGVQHLEASEADVQKLMI QQLETILPGLPQPVATICHKWTYSQVTSSVSDRPGQMTLHLKPFLVCGGD GFTHSNFNGCISSALSVMKVLKRYI
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      18 to 342
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 18 to 342 with a 6xHis-SUMO tag at the N-terminus. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 6530404N21Rik
    • AI452315
    • AW060440
    • C10orf59
    • Chromosome 10 open reading frame 59
    • FLJ11218
    • HGNC:25641
    • Hypothetical protein LOC55328
    • MAO C
    • MAO-C
    • mMAO C
    • Monoamine oxidase C
    • Monoamine oxidase-C
    • Renalase
    • Renalase FAD dependent amine oxidase
    • RNLS
    • RNLS_HUMAN
    see all
  • Function

    Probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. Degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. Lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis (By similarity). According to PubMed:17385068, is unlikely that renalase has physiologically relevant catecholamine-oxidizing activity.
  • Tissue specificity

    Secreted into the blood by the kidney. Highly expressed in the kidney, expressed at lower level in heart, skeletal muscle and small intestine. Its plasma concentration is markedly reduced in patients with end-stage renal disease, as compared with healthy subjects.
  • Sequence similarities

    Belongs to the renalase family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226429 with 5% enrichment gel and 15% separation gel.

References

ab226429 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up