Description

  • Product name

    Recombinant Mouse RKIP protein
    See all RKIP proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAADISQWAGPLCLQEVDEPPQHALRV DYAGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRK DPKFREWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRYVWLVYEQ EQPLSCDEPILSNKSGDNRGKFKVETFRKKYNLGAPVAGTCYQAEWDDYV PKLYEQLSGK
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      1 to 187
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_061346.

Specifications

Our Abpromise guarantee covers the use of ab207111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • Epididymis luminal protein 210
    • Epididymis secretory protein Li 34
    • Epididymis secretory protein Li 96
    • HCNP
    • HCNPpp
    • HEL 210
    • HEL S 34
    • HEL S 96
    • Hippocampal cholinergic neurostimulating peptide
    • Neuropolypeptide h3
    • PBP
    • PEBP
    • PEBP 1
    • PEBP-1
    • Pebp1
    • PEBP1_HUMAN
    • Phosphatidylethanolamine binding protein
    • Phosphatidylethanolamine binding protein 1
    • Prostatic binding protein
    • Prostatic-binding protein
    • R kip
    • Raf kinase inhibitor protein
    • Raf kinase inhibitory protein
    • RKIP
    see all
  • Function

    Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.
    HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.
  • Sequence similarities

    Belongs to the phosphatidylethanolamine-binding protein family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab207111 (3µg).

References

ab207111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up