Description

  • Product name

    Recombinant Mouse RPLP0 protein (Tagged)
    See all RPLP0 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGK AVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRD MLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRG TIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLIIQQVFDNGSIYN PEVLDITEQALHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLA LSVETEYTFPLTEKVKAFLADPSAFAAAAPAAAATTAAPAAAAAPAKAEA KEESEESDEDMGFGLFD
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      1 to 317
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab226428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 36B4
    • 60S acidic ribosomal protein P0
    • 60S ribosomal protein L10E
    • Acidic ribosomal phosphoprotein P0
    • Arbp
    • L10E
    • LP0
    • MGC107165
    • MGC107166
    • MGC111226
    • MGC88175
    • OTTMUSP00000015585
    • P0
    • PRLP0
    • Ribosomal phosphoprotein, acidic, P0
    • Ribosomal protein P0
    • Ribosomal protein, large, P0
    • RLA0_HUMAN
    • rplP0
    • RPP0
    see all
  • Function

    Ribosomal protein P0 is the functional equivalent of E.coli protein L10.
  • Sequence similarities

    Belongs to the ribosomal protein L10P family.
  • Cellular localization

    Nucleus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226428 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab226428 could indicate that this peptide derived from E.coli-expressed mouse RPLP0.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab226428 could indicate that this peptide derived from E.coli-expressed mouse RPLP0.

References

ab226428 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226428.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up