Description

  • Product name

    Recombinant Mouse RSPO1 protein (His tag)
    See all RSPO1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab222952 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      ADPSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERN DIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQEG LYLHKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCG FRKGSEERTRRVLHAPGGDHTTCSDTKETRKCTVRRTPCPEGQKRRKGGQ GRRENANRHPARKNSKEPGSNSRRHKGQQQPQPGTTGPLTSVGPTWAQHH HHHH
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      21 to 265
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 21 to 265. The signal peptide is not included (NP_619624).

Specifications

Our Abpromise guarantee covers the use of ab222952 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CRISTIN3
    • FLJ40906
    • hRspo1
    • R spondin homolog
    • R spondin homolog (Xenopus laevis)
    • R spondin1
    • R-spondin-1
    • Roof plate specific spondin
    • Roof plate-specific spondin-1
    • RP11-566C13.1
    • RSPO
    • Rspo1
    • RSPO1_HUMAN
    see all
  • Function

    Activator of the beta-catenin signaling cascade, leading to TCF-dependent gene activation. Acts both in the canonical Wnt/beta-catenin-dependent pathway, possibly via a direct interaction with Wnt proteins, and in a Wnt-independent beta catenin pathway through a receptor signaling pathway that may not use frizzled/LRP receptors. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination.
  • Tissue specificity

    Abundantly expressed in adrenal glands, ovary, testis, thyroid and trachea but not in bone marrow, spinal cord, stomach, leukocytes colon, small intestine, prostate, thymus and spleen.
  • Involvement in disease

    Defects in RSPO1 are the cause of palmoplantar keratoderma with squamous cell carcinoma of skin and sex reversal (PKKSCC) [MIM:610644]. This recessive syndrome is characterized by XX (female to male) SRY-independent sex reversal, palmoplantar hyperkeratosis and predisposition to squamous cell carcinoma of the skin.
  • Sequence similarities

    Belongs to the R-spondin family.
    Contains 2 FU (furin-like) repeats.
    Contains 1 TSP type-1 domain.
  • Domain

    The FU repeats are required for activation and stabilization of beta-catenin.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222952.

    MWt 28-40 kDa (SDS-PAGE under reducing conditions).

References

ab222952 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222952.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up