Recombinant Mouse S100 alpha protein (ab108117)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSELESAMETLINVFHAHSGKEGDKYKLS KKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVA ALTVACNNFFWETS
    • Molecular weight
      13 kDa including tags
    • Amino acids
      1 to 94
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab108117 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 30% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Bpb
    • NEF
    • Protein S100-A1
    • S-100 protein alpha chain
    • S-100 protein subunit alpha
    • S100
    • S100 alpha
    • S100 Alpha Chain
    • S100 Beta Chain
    • S100 Calcium Binding Protein A1
    • S100 Calcium Binding Protein B
    • S100 Calcium Binding Protein Beta Neural
    • S100 calcium-binding protein A1
    • S100 protein alpha polypeptide
    • S100A
    • s100a1
    • S10A1_HUMAN
    see all
  • Function
    Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites.
  • Tissue specificity
    Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.
  • Sequence similarities
    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab108117 at approximately 12.6kDa (3µg).

References

ab108117 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up