Description

  • Product name

    Recombinant Mouse S100A4 protein
    See all S100A4 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab109341 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMARPLEEALDVIVSTFHKYSGKEGDKFKLN KTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLS CIAMMCNEFFEGCPDKEPRKK
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      1 to 101
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • 18A2
    • 42A
    • calcium Placental protein
    • Calvasculin
    • CAPL
    • Fibroblast specific protein
    • Fibroblast specific protein 1
    • Fibroblast specific protein 1 (FSP1)
    • FSP1
    • Leukemia multidrug resistance associated protein
    • Malignant transformation suppression 1
    • Malignant transformation suppression 1 (MTS1)
    • Metastasin
    • MTS1
    • OTTHUMP00000015467
    • OTTHUMP00000015468
    • P9KA
    • PEL98
    • Placental calcium-binding protein
    • Protein Mts1
    • Protein S100 A4
    • Protein S100-A4
    • S100 calcium binding protein A4
    • S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)
    • S100 calcium-binding protein A4
    • S100a4
    • S10A4_HUMAN
    see all
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab109341.

References

ab109341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up