Description

  • Product name

    Recombinant Mouse SCF protein
    See all SCF proteins and peptides
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMV IQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIK ESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKD SRVSVTKPFMLPPVA
    • Predicted molecular weight

      18 kDa
    • Additional sequence information

      Corresponds to the sequence of the secreted soluble form of SCF

Associated products

Specifications

Our Abpromise guarantee covers the use of ab9754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    n/a

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • C kit ligand
    • C-kit ligand
    • Ckit ligand
    • DCUA
    • DFNA69
    • DKFZp686F2250
    • familial progressive hyperpigmentation 2
    • FPH2
    • FPHH
    • KIT ligand
    • Kitl
    • KITLG
    • KL 1
    • KL1
    • Mast cell growth factor
    • MGF
    • MGF stem cell factor
    • SCF
    • SCF_HUMAN
    • SF
    • SHEP7
    • sKITLG
    • Soluble KIT ligand
    • Steel factor
    • steel, mouse, homolog of
    • Stem cell factor
    • Stem cell factor precursor
    see all
  • Function

    Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
  • Involvement in disease

    Hyperpigmentation with or without hypopigmentation, familial progressive
    Deafness, congenital, unilateral or asymmetric
  • Sequence similarities

    Belongs to the SCF family.
  • Developmental stage

    Acts in the early stages of hematopoiesis.
  • Post-translational
    modifications

    A soluble form (sKITLG) is produced by proteolytic processing of isoform 1 in the extracellular domain.
    Found in two differentially glycosylated forms, LMW-SCF and HMW-SCF. LMW-SCF is fully N-glycosylated at Asn-145, partially N-glycosylated at Asn-90, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97 or Asn-118. HMW-SCF is N-glycosylated at Asn-118, Asn-90 and Asn-145, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97.
    A soluble form exists as a cleavage product of the extracellular domain.
  • Cellular localization

    Secreted; Cell membrane and Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane. Cell projection, lamellipodium. Cell projection, filopodium.
  • Information by UniProt

References

This product has been referenced in:

  • Schäfer-Somi S  et al. Pre-pubertal treatment with a GnRH agonist in bitches-Effect on the uterus and hormone receptor expression. Reprod Domest Anim 53 Suppl 3:103-109 (2018). Read more (PubMed: 30474335) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab9754.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up