Description

  • Product name

    Recombinant Mouse SCGB3A2 protein (Tagged)
    See all SCGB3A2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDE LGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRD SKKQTFAFIERVFEQSKL
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      22 to 139
    • Additional sequence information

      Full-length mature chain lacking the signal peptide. N-terminal 6xHis-GST-tagged

Specifications

Our Abpromise guarantee covers the use of ab239571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • LU103
    • Pneumo secretory protein 1
    • PnSP-1
    • PNSP1
    • SCGB3A2
    • Secretoglobin family 3A member 2
    • SG3A2_HUMAN
    • UGRP1
    • Uteroglobin-related protein 1
    see all
  • Tissue specificity

    Highly expressed in lung.
  • Sequence similarities

    Belongs to the secretoglobin family. UGRP subfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab239571 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab239571 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239571.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up