Description

  • Product name

    Recombinant Mouse SEMA4A protein (Fc Chimera)
    See all SEMA4A proteins and peptides
  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MALPSLGQDSWSLLRVFFFQLFLLPSLPPASGTGGQGPMPRVKYHAGDGH RALSFFQQKGLRDFDTLLLSDDGNTLYVGAREAVLALNIQNPGIPRLKNM IPWPASERKKTECAFKKKSNETQCFNFIRVLVSYNATHLYACGTFAFSPA CTFIELQDSLLLPILIDKVMDGKGQSPFDPVHKHTAVLVDGMLYSGTMNN FLGSEPILMRTLGSQPVLKTDIFLRWLHADASFVAAIPSTQVVYFFFEET ASEFDFFEELYISRVAQVCKNDVGGEKLLQKKWTTFLKAQLLCAQPGQLP FNIIRHAVLLPADSPSVSRIYAVFTSQWQVGGTRSSAVCAFSLTDIERVF KGKYKELNKETSRWTTYRGSEVSPRPGSCSMGPSSDKALTFMKDHFLMDE HVVGTPLLVKSGVEYTRLAVESARGLDGSSHVVMYLGTSTGSLHKAVVPQ DSSAYLVEEIQLSPDSEPVRNLQLAPAQGAVFAGFSGGIWRVPRANCSVY ESCVDCVLARDPHCAWDPESRLCSLLSGSTKPWKQDMERGNPEWVCTRGP MARSPRRQSPPQLIKEVLTVPNSILELPCPHLSALASYHWSHGRAKISEA SATVYNGSLLLLPQDGVGGLYQCVATENGYSYPVVSYWVDSQDQPLALDP ELAGVPRERVQVPLTRVGGGASMAAQ
    • Amino acids

      1 to 676
    • Additional sequence information

      Fused to the N-terminus of the Fc region of Human IgG1.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab214826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Reconstitution
    Reconstitute at 100 µg/mL in sterile PBS. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • CORD10
    • RP11 54H19 2
    • RP35
    • SEM4A_HUMAN
    • Sema B
    • Sema domain immunoglobulin domain Ig transmembrane domain TM and short cytoplasmic domain 4A
    • Sema domain immunoglobulin domain Ig transmembrane domain TM and short cytoplasmic domain semaphorin 4A
    • Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin)
    • Sema4a
    • SEMAB
    • Semaphorin 4A precursor
    • Semaphorin B
    • Semaphorin-4A
    • Semaphorin-B
    • SEMB
    see all
  • Function

    Inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
  • Involvement in disease

    Defects in SEMA4A are the cause of retinitis pigmentosa type 35 (RP35) [MIM:610282]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
    Defects in SEMA4A are the cause of cone-rod dystrophy type 10 (CORD10) [MIM:610283]. CORDs are inherited retinal dystrophies belonging to the group of pigmentary retinopathies. CORDs are characterized by retinal pigment deposits visible on fundus examination, predominantly in the macular region, and initial loss of cone photoreceptors followed by rod degeneration. This leads to decreased visual acuity and sensitivity in the central visual field, followed by loss of peripheral vision. Severe loss of vision occurs earlier than in retinitis pigmentosa.
  • Sequence similarities

    Belongs to the semaphorin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 PSI domain.
    Contains 1 Sema domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab214826 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up