Description

  • Product name

    Recombinant Mouse SERPINE2/PN-1 protein (His tag)
    See all SERPINE2/PN-1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab222348 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      SQFNSLSLEELGSNTGIQVFNQIIKSRPHENVVVSPHGIASILGMLQLGA DGKTKKQLSTVMRYNVNGVGKVLKKINKAIVSKKNKDIVTVANAVFLRNG FKMEVPFAVRNKDVFQCEVQNVNFQDPASASESINFWVKNETRGMIDNLL SPNLIDGALTRLVLVNAVYFKGLWKSRFQPESTKKRTFVAGDGKSYQVPM LAQLSVFRSGSTRTPNGLWYNFIELPYHGESISMLIALPTESSTPLSAII PHITTKTIDSWMNTMVPKRMQLVLPKFTAVAQTDLKEPLKALGITEMFEP SKANFTKITRSESLHVSHILQKAKIEVSEDGTKASAATTAILIARSSPPW FIVDRPFLFSIRHNPTGAILFLGQVNKPLEHHHHHH
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      20 to 397
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 20 to 397. The signal peptide is not included (NP_033281).

Specifications

Our Abpromise guarantee covers the use of ab222348 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as SERPINE2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • GDN
    • GDN_HUMAN
    • GDNPF
    • Glia derived nexin
    • Glia-derived nexin
    • Glial derived neurite promoting factor
    • P17
    • Peptidase inhibitor 7
    • Pi-7
    • Plasminogen activator inhibitor type 1, member 2
    • PN-1
    • PN1
    • PNI
    • Protease inhibitor 7
    • Protease nexin 1
    • Protease nexin I
    • Serpin E2
    • Serpin family E member 2
    • Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2
    • SERPINE 2
    • Serpine2
    see all
  • Function

    Serine protease inhibitor with activity toward thrombin, trypsin, and urokinase. Promotes neurite extension by inhibiting thrombin. Binds heparin.
  • Sequence similarities

    Belongs to the serpin family.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222348.

    MWt 40-57 kDa (SDS–PAGE under reducing conditions).

References

ab222348 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222348.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up