Description

  • Product name

    Recombinant Mouse SFRP5 protein (His tag)
    See all SFRP5 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      APTRGQEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPLCHTVGYKRMRLP NLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIYPC RSLCEAARAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATA PPVTKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIDNGDRKLIGAQ KKKKLLKAGPLKRKDTKKLVLHMKNGASCPCPQLDNLTGSFLVMGRKVEG QLLLTAVYRWDKKNKEMKFAVKFMFSYPCSLYYPFFYGAAEPH
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      22 to 314
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 22 to 314. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab235970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Frizzled related protein 1b
    • FRP 1b
    • FRP1b
    • SARP 3
    • SARP3
    • Secreted apoptosis related protein 3
    • Secreted frizzled related protein 5
    • SFRP 5
    see all
  • Relevance

    Secreted frizzled-related protein 5 (SFRP5) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. SFRP5 and SFRP1 may be involved in determining the polarity of photoreceptor cells in the retina. SFRP5 is highly expressed in the retinal pigment epithelium, and moderately expressed in the pancreas.
  • Cellular localization

    Secreted

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel analysis of ab235970.

References

ab235970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up