Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MVARNQVAADNAISPAAEPRRRSEPSSSSSSSSPAAPVRPRPCPAVPAPA PGDTHFRTFRSHSDYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVG TFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRETFDCLFE LLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVAAVGRENLARIPLNPV LRDYLSSFPFQI
    • Molecular weight

      29 kDa including tags
    • Amino acids

      1 to 212
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab236163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • CISH 1
    • CISH1
    • Cytokine inducible SH2 protein 1
    • JAB
    • JAK binding protein
    • JAK-binding protein
    • Janus kinase binding protein
    • SOCS 1
    • SOCS-1
    • Socs1
    • SOCS1_HUMAN
    • SSI 1
    • SSI-1
    • SSI1
    • STAT induced STAT inhibitor 1
    • STAT-induced STAT inhibitor 1
    • Suppressor of cytokine signaling 1
    • Supressor of cytokine signalling 1
    • TEC interacting protein 3
    • Tec-interacting protein 3
    • TIP 3
    • TIP-3
    • TIP3
    see all
  • Function

    SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS1 is involved in negative regulation of cytokines that signal through the JAK/STAT3 pathway. Through binding to JAKs, inhibits their kinase activity. In vitro, also suppresses Tec protein-tyrosine activity. Appears to be a major regulator of signaling by interleukin 6 (IL6) and leukemia inhibitory factor (LIF). Regulates interferon-gamma mediated sensory neuron survival (By similarity). Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize JAK2.
  • Tissue specificity

    Expressed in all tissues with high expression in spleen, small intestine and peripheral blood leukocytes.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 SH2 domain.
    Contains 1 SOCS box domain.
  • Domain

    The ESS and SH2 domains are required for JAK phosphotyrosine binding. Further interaction with the KIR domain is necessary for signal and kinase inhibition.
    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes. The Elongin BC complex binding domain is also known as BC-box with the consensus [APST]-L-x(3)-C-x(3)-[AILV] and is part of the SOCS box.
  • Information by UniProt

Images

  • ab236163 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab236163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up