Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      AAAVAVAGGRSDGGNFLDEKQWLTTISQYDKEVGQWNKFRDEVEDDYFRT WNPGKPFDQALDPAKDPCLKTKCSRHKVCITQDAQTALCISHRRLTHSMK EVGGSHKQWRGLPSSTCKPCPIAYASPVCGSDGHSYSSQCKLEYQACVLG KQISIKCEGRCPCPSDKSMNIGRNVKRACSDLEFREVANRLRDWFKALHE SGSQNKKTKALLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSE LGSIYLDKNEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCHTELS NIQKRQGIKKLLGQYIPLCDEDGYYKPTQCHGSVGQCWCVDRYGNEVVGS RINGVADCAIDFEISGDFASGDFREWTDDEGEEDDIMNDKDDIEDDDEDE GDDDDDGDVHDGYIVDHHHHHH
    • Molecular weight

      48 kDa including tags
    • Amino acids

      23 to 436
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab194020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

  • Reconstitution
    Reconstituted protein solution can be stored at 4-7 deg.C for 2-7 days. Aliquots of reconstituted samples are stable at < -20 deg.C for 3 months.

General Info

  • Alternative names

    • HSAJ1454
    • OTTHUMP00000219853
    • OTTHUMP00000219854
    • OTTHUMP00000219857
    • OTTHUMP00000219858
    • OTTHUMP00000219862
    • OTTHUMP00000219864
    • OTTHUMP00000219865
    • OTTHUMP00000219866
    • OTTHUMP00000219867
    • OTTHUMP00000219868
    • Sparc/osteonectin, cwcv and kazal like domains proteoglycan (testican) 3
    • SPARC/osteonectin, CWCV, and Kazal like domains proteoglycan 3
    • TES 3
    • testican 3
    • TICN3
    see all
  • Relevance

    SPOCK3 may participate in diverse steps of neurogenesis. It inhibits the processing of pro-matrix metalloproteinase 2 (MMP-2) by MT1-MMP and MT3-MMP and may also interfere with tumor invasion.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix.

References

ab194020 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up