Description

  • Product name

    Recombinant Mouse SRPX2 protein (Tagged)
    See all SRPX2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCY SPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRC HTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGG EPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVT LRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQH GYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPM KINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLD LRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLID KQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      26 to 468
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full-length mature chain with N-terminal 10xHis-SUMO tag and C-terminal Myc tag.

Specifications

Our Abpromise guarantee covers the use of ab226228 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • BPP
    • CBPS
    • PMGX
    • RESDX
    • SRPUL
    • SRPX 2
    • SRPX2
    • SRPX2_HUMAN
    • Sushi repeat containing protein SRPX2
    • Sushi repeat containing protein X linked 2
    • Sushi repeat protein
    • Sushi repeat-containing protein SRPX2
    see all
  • Function

    Acts as a ligand for the urokinase plasminogen activator surface receptor. Plays a role in angiogenesis by inducing endothelial cell migration and the formation of vascular network (cords). Involved in cellular migration and adhesion in cancer cells. Increases the phosphorylation levels of FAK. May have a role in the perisylvian region, critical for language and cognitive development.
  • Tissue specificity

    Expressed in neurons of the rolandic area of the brain (at protein level). Highly expressed in the brain, placenta, lung, trachea, uterus and adrenal gland. Weakly expressed in the peripheral blood, brain and bone marrow. Expressed in numerous cancer cell lines.
  • Involvement in disease

    Defects in SRPX2 are a cause of bilateral perisylvian polymicrogyria (BPP) [MIM:300388]. BPP is the most common form of polymicrogyria, a malformation of the cortex, in which the brain surface is irregular and the normal gyral pattern replaced by multiple small, partly fused, gyri separated by shallow sulci. BPP results in mild mental retardation, epilepsy and pseudobulbar palsy, causing difficulties with expressive speech and feeding.
    Defects in SRPX2 are a cause of rolandic epilepsy with speech dyspraxia and mental retardation X-linked (RESDX) [MIM:300643]. A condition characterized by the association of rolandic seizures with oral and speech dyspraxia, and mental retardation. Rolandic occur during a period of significant brain maturation. During this time, dysfunction of neural network activities such as focal discharges may be associated with specific developmental disabilities resulting in specific cognitive impairments of language, visuo-spatial abilities or attention.
  • Sequence similarities

    Contains 1 HYR domain.
    Contains 3 Sushi (CCP/SCR) domains.
  • Cellular localization

    Cytoplasm. Secreted.
  • Information by UniProt

Images

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP819154MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Srpx2.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab226228 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Srpx2.

References

ab226228 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226228.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up