Description

  • Product name

    Recombinant Mouse STIP1/STI1 protein (His tag)
    See all STIP1/STI1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMEQVNELKEKGNKALSAGNIDDALQCYSEA IKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAA ALEFLNRFEEAKRTYEEGLKHEANNLQLKEGLQNMEARLAERKFMNPFNL PNLYQKLENDPRTRSLLSDPTYRELIEQLQNKPSDLGTKLQDPRVMTTLS VLLGVDLGSMDEEEEAATPPPPPPPKKEPKPEPMEEDLPENKKQALKEKE LGNDAYKKKDFDKALKHYDRAKELDPTNMTYITNQAAVHFEKGDYNKCRE LCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAHFYNKSLAEHR TPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMK HYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGY TRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDS PEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKI QKLMDVGLI AIR
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      1 to 543
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab219449 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as STIP1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 10% Glycerol, 0.32% Tris HCl, 0.02% DTT, 0.58% Sodium chloride

General Info

  • Alternative names

    • Epididymis secretory sperm binding protein Li 94n
    • HEL S 94n
    • Hop
    • Hsc70/Hsp90 organizing protein
    • Hsc70/Hsp90-organizing protein
    • IEF SSP 3521
    • NY REN 11 antigen
    • P60
    • Renal carcinoma antigen NY-REN-11
    • STI1
    • STI1L
    • STIP1
    • STIP1_HUMAN
    • Stress induced phosphoprotein 1
    • Stress-induced-phosphoprotein 1
    • Transformation sensitive protein IEF SSP 3521
    • Transformation-sensitive protein IEF SSP 3521
    see all
  • Function

    Mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
  • Sequence similarities

    Contains 2 STI1 domains.
    Contains 9 TPR repeats.
  • Domain

    The TPR 1 repeat interacts with the C-terminal of HSC70. The TPR 4, 5 and 6 repeats (also called TPR2A domain) and TPR 7, 8 and 9 repeats (also called TPR2B domain) interact with HSP90.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE using 3μg of ab219449.

References

ab219449 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219449.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up