Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGANTSSKAPVFDENEDVNFDHFEILRAIGKGSFGKVCIVRKNDTKKMYA MKYMNKQKCVERNEVRNVFKELQIMQGLEHPFLVNLWYSFQDEEDMFMVV DLLLGGDLRYHLQQNVHFQEDTVKLFICELAMALDYLQSQRIIHRDMKPD NILLDEHGHVHITDFNIAAMLPKETRITTVAGTKPYMAPEMFTSRKETGY SFAVDWWSLGVTAYELLRGRRPYHIRSSTSSKEIVNMFETAIVTYPSAWS QEMVSLLKKLLEPNPDQRFSHLTDIQNFPYMSDMNWDAVLQKRLIPGFIP TKGRLNCDPTFELEEMILESKPLHKKKKRLAKREKEMKKSDSSQTCLLQE HLDAVQKEFIIFNREKVKSDFNQRQANLALEQTKNNTEEEEDGQNNNL
    • Molecular weight

      71 kDa including tags
    • Amino acids

      1 to 368
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab204135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 95 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 25% Glycerol, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 0.31% Glutathione, 0.29% Sodium chloride, 0.79% Tris HCl

General Info

  • Alternative names

    • A930015B13Rik
    • MGC22688
    • Serine/threonine kinase 32A
    • Serine/threonine protein kinase 32A
    • Serine/threonine-protein kinase 32A
    • ST32A_HUMAN
    • STK 32A
    • Stk32a
    • YANK 1
    • YANK1
    • Yet another novel kinase 1
    see all
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE showing ab204135.

References

ab204135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up