Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWM SEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRI IKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGT WESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREI KKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYP FMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI
    • Molecular weight

      34 kDa
    • Amino acids

      1 to 291
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab236336 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as SULT1A1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Aryl sulfotransferase 1
    • HAST1/HAST2
    • Human aryl sulfotransferase mRNA complete cds
    • MGC131921
    • MGC5163
    • OTTHUMP00000162568
    • OTTHUMP00000162569
    • P PST 1
    • P PST
    • P-PST 1
    • Phenol sulfating phenol sulfotransferase 1
    • Phenol sulfotransferase 1
    • Phenol-sulfating phenol sulfotransferase 1
    • PST
    • ST1A1
    • ST1A1_HUMAN
    • ST1A3
    • STP
    • STP1
    • Sulfotransferase 1A1
    • Sulfotransferase family 1A phenol preferring member 1
    • Sulfotransferase family cytosolic 1A phenol preferring member 1
    • Sulfotransferase phenol preferring 1
    • SULT1A1
    • Thermostable phenol sulfotransferase
    • Thermostable phenol sulfotransferase1
    • Ts-PST
    • TSPST1
    see all
  • Function

    Catalyzes the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Is also responsible for the sulfation and activation of minoxidil. Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.
  • Tissue specificity

    Liver, lung, adrenal, brain, platelets and skin.
  • Sequence similarities

    Belongs to the sulfotransferase 1 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236336.

References

ab236336 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236336.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up