Description

  • Product name

    Recombinant mouse TARC/CCL17 protein (Active)
    See all TARC/CCL17 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLIC ADPKDKHVKKAIRLVKNPRP
    • Predicted molecular weight

      8 kDa
    • Amino acids

      24 to 93
    • Additional sequence information

      Full-length mature chain lacking the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab243258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as TARC

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • A-152E5.3
    • A152E53
    • ABCD 2
    • ABCD2
    • C-C motif chemokine 17
    • CC chemokine TARC
    • CCL17
    • CCL17_HUMAN
    • Chemokine CC Motif Ligand 17
    • MGC138271
    • MGC138273
    • SCYA17
    • Small Inducible Cytokine A17
    • Small Inducible Cytokine A17 Precursor
    • Small Inducible Cytokine Subfamily A (Cys Cys)
    • Small Inducible Cytokine Subfamily A (Cys Cys) Member 17
    • Small-inducible cytokine A17
    • T Cell Directed CC Chemokine
    • Thymus and activation regulated chemokine
    • Thymus and activation-regulated chemokine
    see all
  • Function

    Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4.
  • Tissue specificity

    Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS Page analysis of ab243258

References

ab243258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up