Description

  • Product name

    Recombinant Mouse TEM7 protein (His tag)
    See all TEM7 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      LSPATPAGHNEGQDSAWTAKRTRQGWSRRPRESPAQVLKPGKTQLSQDLG GGSLAIDTLPDNRTRVVEDNHNYYVSRVYGPGEKQSQDLWVDLAVANRSH VKIHRILSSSHRQASRVVLSFDFPFYGHPLRQITIATGGFIFMGDMLHRM LTATQYVAPLMANFNPGYSDNSTVAYFDNGTVFVVQWDHVYLQDREDRGS FTFQAALHRDGRIVFGYKEIPMAVLDISSAQHPVKAGLSDAFMILNSSPE VPASQRRTIFEYHRVELDSSKITTTSAVEFTPLPTCLQHQSCDTCVSSNL TFNCSWCHVLQRCSSGFDRYRQEWLTYGCAQEAEGKTCEDFQDDSHYSAS PDSSFSPFNGDSTTSSSLFIDSLTTEDDTKLNPYAEGDGLPDHSSPKSKG PPVHLGT
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      20 to 426
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • DKFZp686F0937
    • FLJ36270
    • FLJ45632
    • OTTHUMP00000164240
    • Plexin domain containing 1
    • Plexin domain containing protein 1 precursor
    • Plexin domain-containing protein 1
    • Plxdc1
    • PXDC1_HUMAN
    • TEM3
    • TEM7
    • Tumor endothelial marker 3
    • Tumor endothelial marker 7
    see all
  • Function

    Plays a critical role in endothelial cell capillary morphogenesis.
  • Tissue specificity

    Detected in endothelial cells from colorectal cancer, and in endothelial cells from primary cancers of the lung, liver, pancreas, breast and brain. Not detectable in endothelial cells from normal tissue. Expressed in fibrovascular membrane with increased expression in individuals with proliferative diabetic retinopathy.
  • Sequence similarities

    Belongs to the plexin family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cytoplasm; Secreted and Cell membrane. Cell junction > tight junction. Localized predominantly at the tight junctions of vascular endothelial cells and to a lesser extent at the luminal surface of vascular endothelial cells.
  • Information by UniProt

Images

  • ab239442 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab239442 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up