Overview

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      HHHHHHSPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAV DFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLS GQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLL VEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAG PGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGLFAGT SLQTLEASDISPGAFNKGSLAFNLQGGLPPSPSLAPDGHTPFPPSPALPT THGSPPQLHPLFPDPSTTMPNSTAPHPVTMYPHPRNLSQET
    • Molecular weight

      36 kDa including tags
    • Amino acids

      22 to 356
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature protein without the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab215631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Lyophilized from a 0.2 µm filtered solution.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term.

  • Reconstitution
    Reconstitute with ddH2O to a concentration no less than 100 µg/mL. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • C mpl ligand
    • C-mpl ligand
    • Megakaryocyte colony stimulating factor
    • Megakaryocyte colony-stimulating factor
    • Megakaryocyte growth and development factor
    • Megakaryocyte stimulating factor
    • MGC163194
    • MGDF
    • MKCSF
    • ML
    • MPL ligand
    • MPLLG
    • Myeloproliferative leukemia virus oncogene ligand
    • Prepro thrombopoietin
    • THCYT1
    • THPO
    • Thrombopoietin
    • Thrombopoietin nirs variant 1
    • TPO
    • TPO_HUMAN
    see all
  • Function

    Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
  • Involvement in disease

    Defects in THPO are a cause of essential thrombocythemia (ET) [MIM:187950]. ET is inherited as an autosomal dominant trait which is characterized by elevated platelet levels due to sustained proliferation of megakaryocytes, and frequently lead to thrombotic and haemorrhagic complications.
  • Sequence similarities

    Belongs to the EPO/TPO family.
  • Domain

    Two-domain structure with an erythropoietin-like N-terminal and a Ser/Pro/Thr-rich C-terminal.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab215631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up