Description

  • Product name

    Recombinant Mouse Thrombospondin 1 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      NRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQDLSSPAFRIENANLIP AVPDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNTGQIFS VVSNGKAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLY IDCDKMESAELDVPIQSIFTRDLASVARLRVAKGDVNDNFQGVLQNVRFV FGTTPEDILRNKGCSSSATNVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQ AICGLSCDELSSMVLELKGLRTIVTTLQDSIRKVTEENRELVSELKRPPL CFHNGVQYKNNEEWTVDSCTECHCQNSVTICK
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      19 to 350
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab236329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • THBS1
    • TSP
    • Tsp1
  • Relevance

    Thrombospondin is a regulator of many biological processes including cell growth, adhesion, migration, platelet aggregation, and fibrin deposition and lysis. It interacts with a number of plasma proteins such as fibrinogen and plasminogen and co-polymerizes with fibrin in clot formation. Thrombospondin also has multiple binding sites that interact with molecules such as fibronectin, collagens, laminin and heparan sulphate proteoglycans as well as binding growth factors such as TGF-beta1. Thrombospondin exerts an anti-adhesive effect which leads to cell rounding and detachment.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236329.

References

ab236329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up