Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLG WHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFL KVQESSVAQFGGGGSHHHHHH
    • Molecular weight

      13 kDa including tags
    • Amino acids

      26 to 135
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab215621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Do not mix by vortex or pipetting.

General Info

  • Alternative names

    • DKFZp667A205
    • ENSMUSG00000071552
    • FLJ39873
    • RGD1563191
    • T cell immunoreceptor with Ig and ITIM domains
    • TIGIT
    • TIGIT_HUMAN
    • V-set and immunoglobulin domain containing 9
    • V-set and immunoglobulin domain-containing protein 9
    • V-set and transmembrane domain containing 3
    • V-set and transmembrane domain-containing protein 3
    • VSIG9
    • VSTM3
    • Washington University cell adhesion molecule
    • WUCAM
    see all
  • Function

    Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells.
  • Tissue specificity

    Expressed at low levels on peripheral memory and regulatory CD4+ T cells and NK cells and is up-regulated following activation of these cells (at protein level).
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab215621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up