Overview

Description

  • Nature

    Recombinant
  • Source

    Insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      YVEVKGVVGHPVTLPCTYSTYRGITTTCWGRGQCPSSACQNTLIWTNGHR VTYQKSSRYNLKGHISEGDVSLTIENSVESDSGLYCCRVEIPGWFNDQKV TFSLQVKPEIPTRPPTRPTTTRPTATGRPTTISTRSTHVPTSIRVSTSTP PTSTHTWTHKPEPTTFCPHETTAEVTGIPSHTPTDWNGTVTSSGDTWSNH TEAIPPGKPQKNPTKGHHHHHH
    • Molecular weight

      24 kDa including tags
    • Amino acids

      22 to 237
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain. NP_599009

Specifications

Our Abpromise guarantee covers the use of ab208469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    ab208469 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • CD365
    • HAVCR
    • HAVCR 1
    • HAVcr-1
    • Havcr1
    • Hepatitis A virus cellular receptor 1
    • Kidney injury molecule 1
    • KIM 1
    • KIM-1
    • T cell immunoglobin domain and mucin domain protein 1
    • T cell immunoglobulin mucin family member 1
    • T cell immunoglobulin mucin receptor 1
    • T-cell immunoglobulin and mucin domain-containing protein 1
    • T-cell membrane protein 1
    • TIM
    • TIM-1
    • TIM1
    • TIMD 1
    • TIMD-1
    • TIMD1
    • TIMD1_HUMAN
    see all
  • Function

    May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). In case of human hepatitis A virus (HHAV) infection, functions as a cell-surface receptor for the virus. May play a role in kidney injury and repair.
  • Tissue specificity

    Widely expressed, with highest levels in kidney and testis. Expressed by activated CD4+ T-cells during the development of helper T-cells responses.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. TIM family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analyis of 3 μg of ab208469.

    40-57 kDa (SDS–PAGE under reducing conditions)

References

ab208469 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up