Description

  • Product name

    Recombinant Mouse Tim 2 protein (Fc Chimera)
  • Purity

    > 98 % SDS-PAGE.

  • Endotoxin level

    < 5.000 Eu/mg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      HTAVQGLAGHPVTLPCIYSTHLGGIVPMCWGLGECRHSYCIRSLIWTNGY TVTHQRNSLYQLKGNISEGNVSLTIENTVVGDGGPYCCVVEIPGAFHFVD YMLEVKPEISTSPPTRPTATGRPTTISTRSTHVPTSTRVSTSTSPTPAHT ETYKPEATTFYPDQTTAEVTETLPDTPADWHNTVTSSDDPWDDNTEVIPP QKPQKNLN
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      22 to 229
    • Additional sequence information

      Extracellular domain fused to the N-terminus of the Fc region of humane IgG1. (NP_001154827.1).

Specifications

Our Abpromise guarantee covers the use of ab215025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Reconstitute vial with 100 µL sterile water. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • AA816106
    • AU019358
    • AU019662
    • C78111
    • G9D3
    • T cell immunoglobulin and mucin domain containing 2
    • T cell immunoglobulin and mucin domain containing 2 protein
    • T-cell immunoglobulin mucin receptor 2
    • T-cell membrane protein 2
    • Tim2
    • Timd2
    see all
  • Relevance

    Tim 2 is a transmembrane protein that is developmentally expressed at very high levels in the 8-cell embryo and the blastocyst. Tim 2 is expressed on activated lymphocytes and has been implicated to play a critical role in the development of atopic disease and other Th2-biased immune responses. Tim 2 is a transmembrane protein containing an immunoglobulin domain and a mucin-like domain.
  • Cellular localization

    Cell membrane; Single pass type I membrane protein

References

ab215025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up