Description

  • Product name

    Recombinant mouse TIM 4 protein (Fc Chimera)
    See all TIM 4 proteins and peptides
  • Biological activity

    Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated Human T cells.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 5.000 Eu/mg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      AASEDTIIGFLGQPVTLPCHYLSWSQSRNSMCWGKGSCPNSKCNAELLRT DGTRIISRKSTKYTLLGKVQFGEVSLTISNTNRGDSGVYCCRIEVPGWFN DVKKNVRLELRRATTTKKPTTTTRPTTTPYVTTTTPELLPTTVMTTSVLP TTTPPQTLATTAFSTAVTTCPSTTPGSFSQETTKGSAFTTESETLPASNH SQRSMMTISTDIAVLRPTGSNPGILPSTSQLTTQKTTLTTSESLQKTTKS HQINSRQT
    • Predicted molecular weight

      85 kDa including tags
    • Amino acids

      22 to 279
    • Additional sequence information

      Extracellular domain fused to the N terminus of the Fc region of mouse IgG2a. (NP_848874.3)

Specifications

Our Abpromise guarantee covers the use of ab215014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilized from 0.2 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100 µl sterile water. Add 1X PBS to the desired protein concentration.

General Info

  • Alternative names

    • SMUCKLER
    • Spleen, mucin-containing, knockout of lymphotoxin protein
    • T cell immunoglobulin and mucin domain containing protein 4
    • T-cell immunoglobulin and mucin domain containing 4
    • T-cell immunoglobulin and mucin domain containing molecule
    • T-cell immunoglobulin and mucin domain-containing protein 4
    • T-cell immunoglobulin and mucin domains-containing protein 4
    • T-cell membrane protein 4
    • TIM-4
    • Tim4
    • TIMD 4
    • TIMD-4
    • Timd4
    • TIMD4_HUMAN
    see all
  • Function

    Phosphatidylserine receptor that enhances the engulfment of apoptotic cells. Involved in regulating T-cell proliferation and lymphotoxin signaling. Ligand for HAVCR1/TIMD1.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. TIM family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Recognizes phosphatidyl serine via its immunoglobulin domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up