Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      GKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIP ESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPA RLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKED KTFFGAFLL
    • Molecular weight

      25 kDa including tags
    • Amino acids

      94 to 252
    • Tags

      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab157011 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Flow Cytometry

  • Endotoxin level

    < 0.100 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Constituent: 99% PBS

  • Reconstitution
    Reconstitute with 100µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein. 0.1mg/ml after reconstitution.

General Info

  • Alternative names

    • MGC129934
    • MGC129935
    • tl1
    • TL1 A
    • tl1a
    • tnf ligand related molecule 1
    • TNF ligand-related molecule 1
    • tnf superfamily ligand tl1a
    • TNF15_HUMAN
    • TNFSF15
    • Tumor necrosis factor (ligand) superfamily member 15
    • Tumor necrosis factor ligand superfamily member 15
    • Tumor necrosis factor ligand superfamily member 15, secreted form
    • Vascular endothelial cell growth inhibitor
    • Vascular endothelial growth inhibitor
    • Vascular endothelial growth inhibitor 192a
    • vegi
    • VEGI192A
    see all
  • Function

    Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis.
  • Tissue specificity

    Specifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Secreted and Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab157011.
    Lane 1: MW Marker
    Lane 2: 1µg ab157011
    Banding observed beneath primary band is immunoreactive with anti-tag antibody.

References

ab157011 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157011.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up