Description

  • Product name

    Recombinant Mouse TMPRSS4 protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVA VRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRA VEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTP RVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDV SSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFS GSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDS TRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGI VSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM
    • Predicted molecular weight

      58 kDa including tags
    • Amino acids

      52 to 435
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Extracellular domain (N-terminal 6xHis-SUMO-tag).

Specifications

Our Abpromise guarantee covers the use of ab239548 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • UNQ776/PRO1570
    • CAPH2
    • Channel-activating protease 2
    • Membrane type serine protease 2
    • Membrane-type serine protease 2
    • MT SP2
    • MT-SP2
    • TMPRSS 4
    • TMPRSS3
    • TMPRSS4
    • TMPS4_HUMAN
    • Transmembrane protease serine 4
    • Transmembrane protease, serine 4
    • Transmembrane serine protease 3
    see all
  • Function

    Probable protease. Seems to be capable of activating ENaC.
  • Tissue specificity

    High levels in pancreatic, gastric, colorectal and ampullary cancer. Very weak expression in normal gastrointestinal and urogenital tract.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 LDL-receptor class A domain.
    Contains 1 peptidase S1 domain.
    Contains 1 SRCR domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab239548.

References

ab239548 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239548.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up