Description

  • Product name

    Recombinant Mouse TPSB2 protein (Tagged)
    See all TPSB2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      IVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHI KSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVP VNVSTHIHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKV PIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRRDSCQGDSGGPLVC KVKGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWIHRYVPEHS
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      32 to 276
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      Full length mature chain without the signal and propeptide.

Specifications

Our Abpromise guarantee covers the use of ab237004 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Mast cell tryptase beta II
    • Mast cell tryptase beta III
    • TPS2
    • TPSB2
    • TRYB2_HUMAN
    • Tryptase beta 2 (gene/pseudogene)
    • Tryptase beta-2
    • Tryptase II
    • Tryptase-2
    • TryptaseB
    • TryptaseC
    see all
  • Function

    Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. Has an immunoprotective role during bacterial infection. Required to efficiently combat K.pneumoniae infection.
  • Sequence similarities

    Belongs to the peptidase S1 family. Tryptase subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted. Released from the secretory granules upon mast cell activation.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel of ab237004.

References

ab237004 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237004.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up