Recombinant Mouse Transferrin Receptor 2/TFR2 protein (Fc Chimera) (ab221026)

Description

  • Product name

    Recombinant Mouse Transferrin Receptor 2/TFR2 protein (Fc Chimera)
    See all Transferrin Receptor 2/TFR2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      RGSCQACGDSVLVVDEDVNPEDSGRTTLYWSDLQAMFLRFLGEGRMEDTI RLTSLRERVAGSARMATLVQDILDKLSRQKLDHVWTDTHYVGLQFPDPAH ANTLHWVDADGSVQEQLPLEDPEVYCPYSATGNATGKLVYAHYGRSEDLQ DLKAKGVELAGSLLLVRVGITSFAQKVAVAQDFGAQGVLIYPDPSDFSQD PHKPGLSSHQAVYGHVHLGTGDPYTPGFPSFNQTQFPPVESSGLPSIPAQ PISADIADQLLRKLTGPVAPQEWKGHLSGSPYRLGPGPDLRLVVNNHRVS TPISNIFACIEGFAEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTF SSMVSNGFRPRRSLLFISWDGGDFGSVGATEWLEGYLSVLHLKAVVYVSL DNSVLGDGKFHAKTSPLLVSLIENILKQVDSPNHSGQTLYEQVALTHPSW DAEVIQPLPMDSSAYSFTAFAGVPAVEFSFMEDDRVYPFLHTKEDTYENL HKMLRGRLPAVVQAVAQLAGQLLIRLSHDHLLPLDFGRYGDVVLRHIGNL NEFSGDLKERGLTLQWVYSARGDYIRAAEKLRKEIYSSERNDERLMRMYN VRIMRVEFYFLSQYVSPADSPFRHIFLGQGDHTLGALVDHLRMLRADGSG AASSRLTAGLGFQESRFRRQLALLTWTLQGAANALSGDVWNIDNNF
    • Predicted molecular weight

      103 kDa including tags
    • Amino acids

      103 to 798
    • Additional sequence information

      This protein carries a mouse IgG1 Fc tag (Val 98-Lys 324; AAK53870.1) at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab221026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Transferrin Receptor 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 5% Trehalose, 0.75% Glycine, Sodium chloride, L-Arginine

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • HFE 3
    • HFE3
    • MGC126368
    • TFR 2
    • TfR2
    • TFR2_HUMAN
    • TFRC 2
    • TFRC2
    • Transferrin receptor 2
    • Transferrin receptor protein 2
    see all
  • Function

    Mediates cellular uptake of transferrin-bound iron in a non-iron dependent manner. May be involved in iron metabolism, hepatocyte function and erythrocyte differentiation.
  • Tissue specificity

    Predominantly expressed in liver. While the alpha form is also expressed in spleen, lung, muscle, prostate and peripheral blood mononuclear cells, the beta form is expressed in all tissues tested, albeit weakly.
  • Involvement in disease

    Defects in TFR2 are a cause of hemochromatosis type 3 (HFE3) [MIM:604250]. HFE3 is a disorder of iron hemostasis resulting in iron overload and has a phenotype indistinguishable from that of hereditary hemochromatosis (HH). HH is characterized by abnormal intestinal iron absorption and progressive increase of total body iron, which results in midlife in clinical complications including cirrhosis, cardiopathy, diabetes, endocrine dysfunctions, arthropathy, and susceptibility to liver cancer. Since the disease complications can be effectively prevented by regular phlebotomies, early diagnosis is most important to provide a normal life expectancy to the affected subjects.
  • Sequence similarities

    Belongs to the peptidase M28 family. M28B subfamily.
  • Cellular localization

    Cell membrane and Cytoplasm. Lacks the transmembrane domain. Probably intracellular.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab221026 stained overnight with Coomassie Blue.

    The reducing protein migrates as 116 kDa in SDS-PAGE due to glycosylation.

References

ab221026 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up