Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      AEELLLERCDLEIQANGRDHHTADLCQEKLVLRRGQRFRLTLYFEGRGYE ASVDSLTFGAVTGPDPSEEAGTKARFSLSDNVEEGSWSASVLDQQDNVLS LQLCTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLYNAWCPADDVYLD SEEERREYVLTQQGFIYQGSVKFIKSVPWNFGQFEDGILDTCLMLLDMNP KFLKNRSRDCSRRSSPIYVGRVVSAMVNCNDDQGVLLGRWDNNYGDGISP MAWIGSVDILRRWKEHGCQQVKYGQCWVFAAVACTVLRCLGIPTRVVTNY NSAHDQNSNLLIEYFRNEFGELESNKSEMIWNFHCWVESWMTRPDLQPGY EGWQAIDPTPQEKSEGTYCCGPVSVRAIKEGDLSTKYDAPFVFAEVNADV VDWIRQEDGSVLKSINRSLVVGQKISTKSVGRDDREDITHTYKYPEGSPE EREVFTKANHLNKLAEKEETGVAMRIRVGDSMSMGNDFDVFAHIGNDTSE TRECRLLLCARTVSYNGVLGPECGTEDINLTLDPYSENSIPLRILYEKYS GCLTESNLIKVRGLLIEPAANSYLLAERDLYLENPEIKIRVLGEPKQNRK LVAEVSLKNPLSDPLYDCIFTVEGAGLTKEQKSVEVSDPVPAGDLVKARV DLFPTDIGLHKLVVNFQCDKLKSVKGYRNVIIGPAVDHHHHHH
    • Molecular weight

      78 kDa including tags
    • Amino acids

      2 to 686
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Full length protein without the initiator methionine.

Specifications

Our Abpromise guarantee covers the use of ab196073 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab196073 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 20% Glycerol, 0.87% Sodium chloride, 0.32% Tris HCl

    0.2 µM filtered solution.

General Info

  • Alternative names

    • ALPHA SUBUNIT
    • C polypeptide
    • EC 2.3.2.13
    • epididymis secretory protein Li 45
    • G alpha h
    • G[a]h
    • Gh CLASS G ALPHA h
    • GNAH
    • GNAH G PROTEIN
    • H POLYPEPTIDE
    • HEL-S-45
    • Protein glutamine gamma glutamyltransferase 2
    • Protein-glutamine gamma-glutamyltransferase 2
    • TG 2
    • TG(C)
    • TG2
    • TGase C
    • TGase H
    • TGase-2
    • TgaseII
    • TGC
    • TGC GUANINE NUCLEOTIDE BINDING PROTEIN
    • TGM2
    • TGM2_HUMAN
    • Tissue transglutaminase
    • Transglutaminase 2
    • Transglutaminase 2 C polypeptide
    • Transglutaminase C
    • Transglutaminase H
    • Transglutaminase-2
    • tTG
    • tTGas
    see all
  • Function

    Catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins.
  • Sequence similarities

    Belongs to the transglutaminase superfamily. Transglutaminase family.
  • Information by UniProt

References

ab196073 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196073.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up