Recombinant mouse TRAP/CD40L protein (Active) (ab220551)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag N-Terminus
- Suitable for: Functional Studies, SDS-PAGE, HPLC, ELISA
Description
-
Product name
Recombinant mouse TRAP/CD40L protein (Active)
See all TRAP/CD40L proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA against immobilized Mouse CD40, Fc Tag (0.2 μg/well). The linear range is 9-78 ng/ml.
-
Purity
> 95 % SDS-PAGE.
>95% as determined by SDS-PAGE. >95% as determined by SEC-MALS. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKR EGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSS QLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL -
Predicted molecular weight
17 kDa including tags -
Amino acids
115 to 260 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab220551 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
HPLC
ELISA
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
pH: 7.40
Constituents: 95% PBS, 5% Trehalose
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- CD 40L
- CD154
- CD40 antigen ligand
see all -
Function
Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching.
Release of soluble CD40L from platelets is partially regulated by GP IIb/IIIa, actin polymerization, and an matrix metalloproteinases (MMP) inhibitor-sensitive pathway. -
Tissue specificity
Specifically expressed on activated CD4+ T-lymphocytes. -
Involvement in disease
Defects in CD40LG are the cause of X-linked immunodeficiency with hyper-IgM type 1 (HIGM1) [MIM:308230]; also known as X-linked hyper IgM syndrome (XHIM). HIGM1 is an immunoglobulin isotype switch defect characterized by elevated concentrations of serum IgM and decreased amounts of all other isotypes. Affected males present at an early age (usually within the first year of life) recurrent bacterial and opportunistic infections, including Pneumocystis carinii pneumonia and intractable diarrhea due to cryptosporidium infection. Despite substitution treatment with intravenous immunoglobulin, the overall prognosis is rather poor, with a death rate of about 10% before adolescence. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Post-translational
modificationsThe soluble form derives from the membrane form by proteolytic processing.
N-linked glycan is a mixture of high mannose and complex type. Glycan structure does not influence binding affinity to CD40.
Not O-glycosylated. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Images
-
SDS-PAGE analysis of ab220551 stained overnight with Coomassie Blue.
The reduced protein migrates as 21-25 kDa in SDS-PAGE.
-
Immobilized Mouse CD40, Fc Tag at 2 μg/ml (100 μl/well) can bind ab220551 with a linear range of 9-78 ng/ml.
-
A SEC-HPLC analysis showing over 95% of ab220551 present as active trimers with a molecular mass of around 50-65 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab220551 has been referenced in 1 publication.
- Dong K et al. The role of SIRT1 in the process of Toxoplasma gondii infection of RAW 264.7 macrophages. Front Microbiol 13:1017696 (2022). PubMed: 36466662