Description

  • Product name

    Recombinant Mouse TRAP/CD40L protein (His tag)
    See all TRAP/CD40L proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab208481 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLT VKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTH SSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKLH HHHHH
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      112 to 260
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_035746. Soluble full length protein.

Specifications

Our Abpromise guarantee covers the use of ab208481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • CD 40L
    • CD154
    • CD40 antigen ligand
    • CD40 ligand
    • CD40 ligand, soluble form
    • CD40-L
    • CD40L
    • CD40L_HUMAN
    • CD40LG
    • gp39
    • hCD40L
    • HIGM1
    • IGM
    • IMD3
    • T B cell activating molecule
    • T BAM
    • T-cell antigen Gp39
    • TNF-related activation protein
    • TNFSF5
    • TrAP
    • Tumor necrosis factor (ligand) superfamily member 5
    • Tumor necrosis factor ligand superfamily member 5
    see all
  • Function

    Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching.
    Release of soluble CD40L from platelets is partially regulated by GP IIb/IIIa, actin polymerization, and an matrix metalloproteinases (MMP) inhibitor-sensitive pathway.
  • Tissue specificity

    Specifically expressed on activated CD4+ T-lymphocytes.
  • Involvement in disease

    Defects in CD40LG are the cause of X-linked immunodeficiency with hyper-IgM type 1 (HIGM1) [MIM:308230]; also known as X-linked hyper IgM syndrome (XHIM). HIGM1 is an immunoglobulin isotype switch defect characterized by elevated concentrations of serum IgM and decreased amounts of all other isotypes. Affected males present at an early age (usually within the first year of life) recurrent bacterial and opportunistic infections, including Pneumocystis carinii pneumonia and intractable diarrhea due to cryptosporidium infection. Despite substitution treatment with intravenous immunoglobulin, the overall prognosis is rather poor, with a death rate of about 10% before adolescence.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications

    The soluble form derives from the membrane form by proteolytic processing.
    N-linked glycan is a mixture of high mannose and complex type. Glycan structure does not influence binding affinity to CD40.
    Not O-glycosylated.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab208481 (3µg). Molexcular weight 18-28KDa (SDS–PAGE under reducing conditions.)

References

ab208481 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up