Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      QFPRVCMTLDGVLNKECCPPLGPEATNICGFLEGRGQCAEVQTDTRPWSG PYILRNQDDREQWPRKFFNRTCKCTGNFAGYNCGGCKFGWTGPDCNRKKP AILRRNIHSLTAQEREQFLGALDLAKKSIHPDYVITTQHWLGLLGPNGTQ PQIANCSVYDFFVWLHYYSVRDTLLGPGRPYKAIDFSHQGPAFVTWHRYH LLWLERELQRLTGNESFALPYWNFATGKNECDVCTDELLGAARQDDPTLI SRNSRFSTWEIVCDSLDDYNRRVTLCNGTYEGLLRRNKVGRNNEKLPTLK NVQDCLSLQKFDSPPFFQNSTFSFRNALEGFDKADGTLDSQVMNLHNLAH SFLNGTNALPHSAANDPVFVVLHSFTDAIFDEWLKRNNPSTDAWPQELAP IGHNRMYNMVPFFPPVTNEELFLTAEQLGYNYAVDLSEEEAPVWSTTLS
    • Molecular weight

      70 kDa including tags
    • Amino acids

      24 to 472
    • Tags

      His tag N-Terminus
    • Additional sequence information

      10xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab224868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    Previously labelled as TRP2

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • L dopachrome tautomerase
    • DCT
    • Dopachrome delta isomerase
    • Dopachrome tautomerase
    • Dopachrome tautomerase dopachrome delta isomerase, tyrosine related protein 2
    • DT
    • EC 5.3.3.12
    • L dopachrome Delta isomerase
    • L-dopachrome Delta-isomerase
    • L-dopachrome tautomerase
    • TRP 2
    • TRP-2
    • TRP2
    • Tyrosinase related protein 2
    • Tyrosinase-related protein 2
    • TYRP2
    • TYRP2_HUMAN
    see all
  • Function

    Involved in regulating eumelanin and phaeomelanin levels.
  • Pathway

    Pigment biosynthesis; melanin biosynthesis.
  • Sequence similarities

    Belongs to the tyrosinase family.
  • Cellular localization

    Melanosome membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab224868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up