Description

  • Product name

    Recombinant mouse TSLP protein
    See all TSLP proteins and peptides
  • Biological activity

    The ED50 tested in a Nag8/7 cell proliferation assay was 0.15 ng/ml, corresponding to a specific activity of approximately 6x106 Units/mg.

  • Purity

    > 99 % SDS-PAGE.

  • Expression system

    Insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEY YTLNPIPGCP SLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEV QNICLNQTSQILRLWYSFMQSP E
    • Predicted molecular weight

      14 kDa
    • Amino acids

      20 to 140
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature protein.

Specifications

Our Abpromise guarantee covers the use of ab181941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Endotoxin Level: Less than 0.1 ng/μg cytokine as determined by LAL assay.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituent: 0.88% Sodium chloride

    Monosodium phosphate 0.4%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Thymic stromal lymphopoietin
    • Thymic stromal lymphopoietin protein TSLP
    • Tslp
    • TSLP protein
    • TSLP_HUMAN
    see all
  • Function

    Cytokine that induces the release of T cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells.
  • Tissue specificity

    Expressed in a number of tissues including heart, liver and prostate.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab181941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up