Description

  • Product name

    Recombinant mouse TWEAKR/FN14 protein
    See all TWEAKR/FN14 proteins and peptides
  • Biological activity

    Binds Human and mouse TWEAK.
    Inhibits TWEAK-mediated killing of Kym-1 target cells.
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLDKCM DCASCPARPHSDFCLGCAAAPPAHF
    • Predicted molecular weight

      34 kDa
    • Amino acids

      1 to 75

Specifications

Our Abpromise guarantee covers the use of ab157284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Binds Human and mouse TWEAK.
    Inhibits TWEAK-mediated killing of Kym-1 target cells.

     This product was previously labelled as TWEAKR

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 99% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 50µl sterile water to a concentration of 1 mg/ml. Further dilutions should be made with medium containing 5% fetal calf serum. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

General Info

  • Alternative names

    • CD 266
    • CD266
    • CD266 antigen
    • FGF inducible 14
    • FGF-inducible 14
    • Fibroblast growth factor inducible immediate early response protein 14
    • Fibroblast growth factor-inducible immediate-early response protein 14
    • FN 14
    • FN14
    • TNFRSF 12A
    • TNFRSF12A
    • TNR12_HUMAN
    • Tumor necrosis factor receptor superfamily member 12A
    • TWEAK R
    • Tweak receptor
    • Tweak-receptor
    • TweakR
    see all
  • Function

    Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.
  • Tissue specificity

    Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas.
  • Sequence similarities

    Contains 1 TNFR-Cys repeat.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab157284 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up