Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMVEIKKICCIGAGYVGGPTCSVIAHMC PEIRVTVVDVNEARINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDD AIREADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVT EKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDR VLIGGDETPEGQKAVRALCAVYEHWVPKEKILTTNTWSSELSKLAANAFL AQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCF QKDVLNLVYLCEALNLPEVARYWQQVIDMNDYQRRRFASRIIDSLFNTVT DKKIAILGFAFKKDTGDTRESSSIYISKYLMDEGAHLHIYDPKVPREQIV VDLSHPGVSADDQVSRLVTISKDPYEACDGAHALVICTEWDMFKELDYER IHKKMLKPAFIFDGRRVLDGLHSELQTIGFQIETIGKKVSSKRIPYTPGE IPKFSLQDPPNKKPKV
    • Molecular weight

      57 kDa including tags
    • Amino acids

      1 to 493
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_033492.

Specifications

Our Abpromise guarantee covers the use of ab229177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 2,500 pmol/min/µg, and is defined as the amount of enzyme that convert 1.0 pmole of UDP-glucose to UDP-glucuronate per minute at pH 8.7 at 37ºC.

  • Applications

    Functional Studies

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab229177 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 5.00
    Constituents: 0.39% MES, 20% Glycerol, 0.87% Sodium chloride, 0.03% EDTA

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • GDH
    • UDP Glc dehydrogenase
    • UDP GlcDH
    • UDP glucose 6 dehydrogenase
    • UDP glucose dehydrogenase
    • UDP-Glc dehydrogenase
    • UDP-GlcDH
    • UDP-glucose 6-dehydrogenase
    • UDP-glucose dehydrogenase
    • UDPGDH
    • UGD
    • Ugdh
    • UGDH_HUMAN
    • Uridine diphospho glucose dehydrogenase
    see all
  • Function

    Involved in the biosynthesis of glycosaminoglycans; hyaluronan, chondroitin sulfate, and heparan sulfate.
  • Tissue specificity

    Widely expressed.
  • Pathway

    Nucleotide-sugar biosynthesis; UDP-alpha-D-glucuronate biosynthesis; UDP-alpha-D-glucuronate from UDP-alpha-D-glucose: step 1/1.
  • Sequence similarities

    Belongs to the UDP-glucose/GDP-mannose dehydrogenase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab229177.

References

ab229177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up