Description

  • Product name

    Recombinant Mouse VE Cadherin protein
    See all VE Cadherin proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab208314 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      GPNFPQIDTPNMLPAHHRQKRDWIWNQMHIDEEKNESLPHYVGKIKSNVN RQNAKYVLQGEFAGKIFGVDANTGNVLAYERLDREKVSEYFLTALIVDKN TNKNLEQPSSFTVKVHDINDNWPVFSHQVFNASVPEMSAIGTSVIRVTAV DADDPTVAGHATVLYQIVKGNEYFSIDNSGLIFTKIKNLDREKQAEYKIV VETQDALGLRGESGTATVMIRLEDINDNFPVFTQSTYTFSVPEDIRVGKP LGFLTVVDPDEPQNRMTKYSIMQGEYRDTFTIETDPKRNEGIIKPTKSLD YEVIQQYTFYIEATDPTIRYEYLSSTSGKNKAMVTINVLDVDEPPVFQRH FYHFKLPENQKKPLIGTVVAKDPDKAQRSIGYSIRKTSDRGQFFRITKQG NIYNEKELDRETYAWYNLTVEANELDSRGNPVGKESIVQVYIEVLDENDN PPEFAQPYEPKVCENAAQGKLVVQISATDKDVVPVNPKFKFALKNEDSNF TLINNHDNTANITVKYGQFNREHAKFHYLPVLISDNGVPSLTGTSTLTVG VCKCNEQGEFTFCEEMAAQAGVSIQLEHHHHHH
    • Predicted molecular weight

      66 kDa including tags
    • Amino acids

      25 to 599
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_033998.

Specifications

Our Abpromise guarantee covers the use of ab208314 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • 7B 4
    • 7B4
    • 7B4 antigen
    • CADH5_HUMAN
    • Cadherin 5
    • Cadherin 5 type 2
    • Cadherin 5, type 2 (vascular endothelium)
    • Cadherin 5, type 2, VE cadherin (vascular epithelium)
    • cadherin, vascular endothelial
    • cadherin, vascular endothelial, 1
    • Cadherin-5
    • Cadherin5
    • CD 144
    • CD144
    • CD144 antigen
    • CDH 5
    • CDH5
    • CDH5 protein
    • Endothelial specific cadherin
    • FLJ17376
    • OTTHUMP00000174777
    • Vascular endothelial cadherin
    • Vascular epithelium cadherin
    • VE Cad
    • VE-cadherin
    • VEC
    see all
  • Function

    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. This cadherin may play a important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions. It associates with alpha-catenin forming a link to the cytoskeleton.
  • Tissue specificity

    Endothelial tissues and brain.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues by KDR/VEGFR-2. Dephosphorylated by PTPRB.
  • Cellular localization

    Cell junction. Cell membrane. Found at cell-cell boundaries and probably at cell-matrix boundaries.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab208314 (3µg).

References

ab208314 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208314.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up