Overview

Description

  • Nature

    Recombinant
  • Source

    Insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MESKALLAVALWFCVETRAASVGLTGDFLHPPKLSTQKDILTILANTTLQ ITCRGQRDLDWLWPNAQRDSEERVLVTECGGGDSIFCKTLTIPRVVGNDT GAYKCSYRDVDIASTVYVYVRDYRSPFIASVSDQHGIVYITENKNKTVVI PCRGSISNLNVSLCARYPEKRFVPDGNRISWDSEIGFTLPSYMISYAGMV FCEAKINDETYQSIMYIVVVVGYRIYDVILSPPHEIELSAGEKLVLNCTA RTELNVGLDFTWHSPPSKSHHKKIVNRDVKPFPGTVAKMFLSTLTIESVT KSDQGEYTCVASSGRMIKRNRTFVRVHTKPFIAFGSGMKSLVEATVGSQV RIPVKYLSYPAPDIKWYRNGRPIESNYTMIVGDELTIMEVTERDAGNYTV ILTNPISMEKQSHMVSLVVNVPPQIGEKALISPMDSYQYGTMQTLTCTVY ANPPLHHIQWYWQLEEACSYRPGQTSPYACKEWRHVEDFQGGNKIEVTKN QYALIEGKNKTVSTLVIQAANVSALYKCEAINKAGRGERVISFHVIRGPE ITVQPAAQPTEQESVSLLCTADRNTFENLTWYKLGSQATSVHMGESLTPV CKNLDALWKLNGTMFSNSTNDILIVAFQNASLQDQGDYVCSAQDKKTKKR HCLVKQLIILGMEASLGDRIAMP
    • Molecular weight

      105 kDa
    • Amino acids

      20 to 660
    • Additional sequence information

      N-terminal sequence: ASVGLPGDFL

Associated products

Specifications

Our Abpromise guarantee covers the use of ab134453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    ab134453 activity was measured by its ability to bind to immobilized recombinant Human VEGF165 in a functional ELISA.
  • Applications

    SDS-PAGE

    ELISA

  • Purity

    > 95 % SDS-PAGE.
    ab134453 was determined to be > 95% pure by SDS-PAGE and silver stain. Endotoxin level:< 0.1 ng per ug of VEGF Receptor 2
  • Form

    Lyophilised
  • Additional notes

    ab134453 is stable for greater than six months at -20° C to -70° C. After the first thawing we recommend aliquoting to avoid freeze-thaw cycles which may decrease the activity. Store at 4°C for not longer than 2 days.

    Disruption of the precise balance of positive and negative molecular regulators of blood and lymphatic vessel growth can lead to myriad diseases. Although dozens of natural inhibitors of hemangiogenesis have been identified, an endogenous selective inhibitor of lymphatic vessel growth has not to our knowledge been previously described. A splice variant of the gene encoding vascular endothelial growth factor receptor-2 (VEGFR-2) that encodes a secreted form of the protein, designated endogenous soluble VEGFR-2 (esVEGFR-2/KDR) has been described. The endogenous soluble esKDR inhibits developmental and reparative lymphangiogenesis by blocking VEGF-C function. Tissue-specific loss of esKDR in mice induced, at birth, spontaneous lymphatic invasion of the normally alymphatic cornea and hyperplasia of skin lymphatics without affecting blood vasculature. Administration of esKDR inhibited lymphangiogenesis but not hemangiogenesis induced by corneal suture injury or transplantation, enhanced corneal allograft survival and suppressed lymphangioma cellular proliferation. Naturally occurring esKDR thus acts as a molecular uncoupler of blood and lymphatic vessels; modulation of esKDR might have therapeutic effects in treating lymphatic vascular malformations, transplantation rejection and, potentially, tumor lymphangiogenesis and lymphedema. Recombinant mouse esKDR generated by alternative splicing consist of the first 6 Ig-like loops followed by the unique C-terminal end: GMEASLGDRIAMP. 

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 5.50
    Constituents: 0.49% MES, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Lyophilized ab134453 is soluble in water and most aqueous buffers. It should be reconstituted in water or PBS to a concentration of not lower than 100µg/ml.

General Info

  • Alternative names

    • CD309
    • CD309 antigen
    • EC 2.7.10.1
    • Fetal liver kinase 1
    • FLK-1
    • FLK1
    • FLK1, mouse, homolog of
    • Kdr
    • Kinase insert domain receptor
    • Kinase insert domain receptor (a type III receptor tyrosine kinase)
    • KRD1
    • Ly73
    • Protein tyrosine kinase receptor FLK1
    • Protein-tyrosine kinase receptor flk-1
    • soluble VEGFR2
    • Tyrosine kinase growth factor receptor
    • Vascular endothelial growth factor receptor 2
    • VEGFR
    • VEGFR 2
    • VEGFR-2
    • VEGFR2
    • VGFR2_HUMAN
    see all
  • Function

    Receptor for VEGF or VEGFC. Has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.
  • Involvement in disease

    Defects in KDR are associated with susceptibility to hemangioma capillary infantile (HCI) [MIM:602089]. HCI are benign, highly proliferative lesions involving aberrant localized growth of capillary endothelium. They are the most common tumor of infancy, occurring in up to 10% of all births. Hemangiomas tend to appear shortly after birth and show rapid neonatal growth for up to 12 months characterized by endothelial hypercellularity and increased numbers of mast cells. This phase is followed by slow involution at a rate of about 10% per year and replacement by fibrofatty stroma.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated. Dephosphorylated by PTPRB. Dephosphorylated by PTPRJ at Tyr-951, Tyr-996, Tyr-1054, Tyr-1059, Tyr-1175 and Tyr-1214.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab134453 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up