Description

  • Product name

    Recombinant Mouse VISTA protein (His tag)
    See all VISTA proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQM CKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITL RNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNE QDSDSITAAHHHHHH
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      33 to 191
    • Tags

      His tag C-Terminus
    • Additional sequence information

      corresponding to extracellular domain

Specifications

Our Abpromise guarantee covers the use of ab215582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    pH: 7.40
    Constituent: PBS

    Lyophilized from a 0.2 µm filtered solution

  • Reconstitution
    Reconstitute with ddH2O to a concentration no less than 100 µg/mL. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • B7 H5
    • B7H5
    • C10orf54
    • chromosome 10 open reading frame 54
    • DD1alpha
    • GI24
    • GI24_HUMAN
    • PD-1H
    • PDCD1 homolog
    • Platelet receptor Gi24
    • PP2135
    • sisp 1
    • SISP1
    • stress induced secreted protein 1
    • UNQ730/PRO1412
    • V domain Ig suppressor of T cell activation
    • V set domain containing immunoregulatory receptor
    • V set immunoregulatory receptor
    • V type immunoglobulin domain containing suppressor of T cell activation
    • VISTA
    see all
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215582 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up